HCA112 specifically recognises human CD81, which is a 26kDa member of the TM4SF tetraspanin family. In humans, CD81 is widely expressed on most tissues with T-cells having the highest level of expression, followed by monocytes and B-cells. Levels of CD81 expression are increased after activation.
CD81 has the ability to interact with a wide range of proteins and plays an important role in a variety of leucocyte functions including activation, proliferation and differentiation. In recent studies, the CD81 molecule has been identified as the putative receptor for the Hepatitis C Virus envelope E2 glycoprotein and is vital for HCV entry into hepatic cells.
Product Form
A bivalent human recombinant Fab selected from the HuCAL ® phage display library, expressed in E.Coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
Storage
Prior to reconstitution store at +4oC.
After reconstitution store at -20oC.
Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life
12 months from date of reconstitution.
Application
This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visitwww.abdserotec.com/protocols.
Application Name
Yes
No
Not Determined
Suggested Dilution
ELISA
Flow Cytometry
Neat - 1/10
Immunohistology - Frozen
Immunohistology - Paraffin
Immunoprecipitation
Western Blotting
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Due to the presence of bovine serum albumin (BSA), this antibody is unsuitable for use as a capture reagent in sandwich ELISA applications. This product is also available without BSA,please enquire.