HCA111 recognises human vimentin, a class III intermediate filament of 54kD. Vimentin is preferentially expressed in mesenchymal tissues, and within the immune system is retained throughout T-cell development, with decreasing expression in B lymphocytes with maturation.
In lymphatic tissues vimentin expression is seen in marginal zone areas, but not in follicle centers. A lack of vimentin expression in B cell lymphoma is indicative of follicular center origin.
Product Form
A bivalent human recombinant Fab selected from the HuCAL ® GOLD phage display library, expressed inE. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a myc-tag (EQKLISEEDL) and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK).
Reconstitution
Reconstitute with 1.0ml distilled water
Care should be taken during reconstitution as the protein may appear as a film at the bottom of the vial. AbD Serotec recommend that the vial is gently mixed after reconstitution.
Storage
Prior to reconstitution store at +4oC.
After reconstitution store at -20oC.
Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life
12 months from date of reconstitution.
Application
This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visitwww.abdserotec.com/protocols.
Application Name
Yes
No
Not Determined
Suggested Dilution
ELISA
Immunohistology - Frozen
Immunohistology - Paraffin
1/50 - 1/200
Immunoprecipitation
Western Blotting
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Due to the presence of bovine serum albumin (BSA), this antibody is unsuitable for use as a capture reagent in sandwich ELISA applications. This product is also available without BSA,please enquire.