HCA104A647 is a recombinant antibody with specificity for Green Fluorescent Protein. It has no known reactivity with mammalian proteins or other antigens. It is therefore recommended as a negative control reagent when using other HuCAL antibodies of the same format. It is recommended that this reagent is used at the same concentration as the test reagent.
Product Form
A bivalent human recombinant Fab selected from the HuCAL® phage display library, expressed inE. coli.This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid and conjugated to Alexa Fluor®647.
Storage
Store at +4oC or at -20oC if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. This product is photosensitive and should be protected from light.
Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life
12 months from date of despatch.
Application
This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visitwww.abdserotec.com/protocols.
Application Name
Yes
No
Not Determined
Suggested Dilution
ELISA
Flow Cytometry
Immunohistology - Frozen
Immunohistology - Paraffin
Immunoprecipitation
Western Blotting
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Sold under license of U.S. Patents 6,300,064, 6,696,248, 6,708,484, 6,753,136, European patent 0,859,841 and corresponding patents.
The Alexa Fluor® dye antibody conjugates in this product are sold under license from Molecular Probes, Inc. for research use only, except for use in combination with microarrays, and are covered by pending and issued patents.
Licensed Use
For in vitro research purposes only, unless otherwise specified in writing by AbD Serotec.